General Information

  • ID:  hor001197
  • Uniprot ID:  P41855
  • Protein name:  FLP-1
  • Gene name:  flp-1
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Each flp gene is expressed in a distinct set of neurons. Flp-1 is expressed in the AVA interneurons, the M5 cholinergic pharyngeal motoneurons, and the AIA, AIY, AVE, AVK, RIG and RMG neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0006937 regulation of muscle contraction; GO:0006972 hyperosmotic response; GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior; GO:0007638 mechanosensory behavior; GO:0046662 regulation of egg-laying behavior; GO:1904014 response to serotonin
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SQPNFLRFG
  • Length:  9
  • Propeptide:  MTLLYQVGLLLLVAATYKVSAECCTPGATSDFCTVFSMLSTMEQNEVMNFIGENCDGDAEVALQKMEKRKPNFMRYGRSAAVKSLGKKAGSDPNFLRFGRSQPNFLRFGKASGDPNFLRFGRSDPNFLRFGKAAADPNFLRFGKRSADPNFLRFGRSFDNFDRESRKPNFLRFGK
  • Signal peptide:  MTLLYQVGLLLLVAATYKVSA
  • Modification:  T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Together with flp-18, plays a homeostatic role by acting on the GABAergic neural transmission at neuromuscular junctions to prevent overexcitation of the locomotor circuit.
  • Mechanism:  [Isoform b]: Expressed at about a twofold higher level than isoform Long.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41855-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001197_AF2.pdbhor001197_ESM.pdb

Physical Information

Mass: 120806 Formula: C49H72N14O13
Absent amino acids: ACDEHIKMTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -54.44 Boman Index: -1868
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 5638.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.